SDR16C5 Antikörper (Middle Region)
-
- Target Alle SDR16C5 (RDHE2) Antikörper anzeigen
- SDR16C5 (RDHE2) (Epidermal Retinal Dehydrogenase 2 (RDHE2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SDR16C5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RDHE2 antibody was raised against the middle region of RDHE2
- Aufreinigung
- Affinity purified
- Immunogen
- RDHE2 antibody was raised using the middle region of RDHE2 corresponding to a region with amino acids AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT
- Top Product
- Discover our top product RDHE2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RDHE2 Blocking Peptide, catalog no. 33R-1208, is also available for use as a blocking control in assays to test for specificity of this RDHE2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDHE2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SDR16C5 (RDHE2) (Epidermal Retinal Dehydrogenase 2 (RDHE2))
- Andere Bezeichnung
- RDHE2 (RDHE2 Produkte)
- Synonyme
- RDH2 antikoerper, RDH-E2 antikoerper, RDHE2 antikoerper, Rdhe2 antikoerper, Scdr9 antikoerper, RGD1565999 antikoerper, rdhe2 antikoerper, sdr16c5 antikoerper, short chain dehydrogenase/reductase family 16C member 5 antikoerper, short chain dehydrogenase/reductase family 16C, member 5 antikoerper, short chain dehydrogenase/reductase family 16C member 5 L homeolog antikoerper, SDR16C5 antikoerper, Sdr16c5 antikoerper, sdr16c5.L antikoerper
- Hintergrund
- The specific function of RDHE2 is not yet known.
- Molekulargewicht
- 34 kDa (MW of target protein)
-