C6orf154 Antikörper (Middle Region)

Produktnummer ABIN633015

Produktdetails anti-C6orf154 Antikörper

Target: C6orf154 (Chromosome 6 Open Reading Frame 154 (C6orf154))

Bindungsspezifität: Middle Region

Reaktivität: Ratte, Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C6orf154 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C6 ORF154 antibody was raised against the middle region of C6 rf154

Aufreinigung: Affinity purified

Immunogen: C6 ORF154 antibody was raised using the middle region of C6 rf154 corresponding to a region with amino acids NLDYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQTLLDMVENY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C6ORF154 Blocking Peptide, catalog no. 33R-6754, is also available for use as a blocking control in assays to test for specificity of this C6ORF154 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF154 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C6orf154

Target: C6orf154 (Chromosome 6 Open Reading Frame 154 (C6orf154))

Andere Bezeichnung: C6ORF154 (C6orf154 Produkte)

Synonyme: C6orf154 antikoerper, LRRC73 antikoerper, nod3l antikoerper, leucine rich repeat containing 73 antikoerper, LRRC73 antikoerper, Lrrc73 antikoerper

Hintergrund: The function of Chromosome 6 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 33 kDa (MW of target protein)