FAM78A Antikörper (N-Term)

Produktnummer ABIN633017

Produktdetails anti-FAM78A Antikörper

Target: FAM78A (Family with Sequence Similarity 78, Member A (FAM78A))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM78A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM78 A antibody was raised against the N terminal of FAM78

Aufreinigung: Affinity purified

Immunogen: FAM78 A antibody was raised using the N terminal of FAM78 corresponding to a region with amino acids MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM78A Blocking Peptide, catalog no. 33R-6279, is also available for use as a blocking control in assays to test for specificity of this FAM78A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM78A

Target: FAM78A (Family with Sequence Similarity 78, Member A (FAM78A))

Andere Bezeichnung: FAM78A (FAM78A Produkte)

Synonyme: fam78a antikoerper, zgc:175187 antikoerper, C9orf59 antikoerper, A130092J06Rik antikoerper, RGD1566351 antikoerper, family with sequence similarity 78 member A antikoerper, family with sequence similarity 78, member Ab antikoerper, family with sequence similarity 78, member A antikoerper, FAM78A antikoerper, fam78ab antikoerper, fam78a antikoerper, Fam78a antikoerper

Hintergrund: The function of FAM78A has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 32 kDa (MW of target protein)