S100PBP Antikörper (Middle Region)
-
- Target Alle S100PBP Antikörper anzeigen
- S100PBP (S100P Binding Protein (S100PBP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser S100PBP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- S100 PBP antibody was raised against the middle region of S100 BP
- Aufreinigung
- Affinity purified
- Immunogen
- S100 PBP antibody was raised using the middle region of S100 BP corresponding to a region with amino acids ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQ
- Top Product
- Discover our top product S100PBP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
S100PBP Blocking Peptide, catalog no. 33R-2713, is also available for use as a blocking control in assays to test for specificity of this S100PBP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of S100 BP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- S100PBP (S100P Binding Protein (S100PBP))
- Andere Bezeichnung
- S100PBP (S100PBP Produkte)
- Synonyme
- s100pbpr antikoerper, S100PBPR antikoerper, 4930429A08Rik antikoerper, AI851343 antikoerper, S100pbpr antikoerper, RGD1564943 antikoerper, S100P binding protein antikoerper, S100P binding protein L homeolog antikoerper, S100PBP antikoerper, s100pbp antikoerper, S100pbp antikoerper, s100pbp.L antikoerper
- Hintergrund
- The function of S100PBP protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 37 kDa (MW of target protein)
-