KRTAP23-1 Antikörper (Middle Region)

Produktnummer ABIN633028

Produktdetails anti-KRTAP23-1 Antikörper

Target: KRTAP23-1 (Keratin Associated Protein 23-1 (KRTAP23-1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KRTAP23-1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KAP23.1 antibody was raised against the middle region of KRTAP23-1

Aufreinigung: Affinity purified

Immunogen: KAP23.1 antibody was raised using the middle region of KRTAP23-1 corresponding to a region with amino acids CEGYLCYSGYSRGGSSYPSNLVYSTEPLISQHLPAGFLSLQGLSGDLLGN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KAP23.1 Blocking Peptide, catalog no. 33R-1676, is also available for use as a blocking control in assays to test for specificity of this KAP23.1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRTAP23-1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KRTAP23-1

Target: KRTAP23-1 (Keratin Associated Protein 23-1 (KRTAP23-1))

Andere Bezeichnung: KAP23.1 (KRTAP23-1 Produkte)

Synonyme: KAP23.1 antikoerper, keratin associated protein 23-1 antikoerper, KRTAP23-1 antikoerper

Hintergrund: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Molekulargewicht: 7 kDa (MW of target protein)