UTP14A Antikörper
-
- Target Alle UTP14A Antikörper anzeigen
- UTP14A (UTP14, U3 Small Nucleolar Ribonucleoprotein, Homolog A (UTP14A))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UTP14A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- UTP14 A antibody was raised using a synthetic peptide corresponding to a region with amino acids KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLL
- Top Product
- Discover our top product UTP14A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UTP14A Blocking Peptide, catalog no. 33R-4729, is also available for use as a blocking control in assays to test for specificity of this UTP14A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UTP10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UTP14A (UTP14, U3 Small Nucleolar Ribonucleoprotein, Homolog A (UTP14A))
- Andere Bezeichnung
- UTP14A (UTP14A Produkte)
- Synonyme
- NYCO16 antikoerper, SDCCAG16 antikoerper, dJ537K23.3 antikoerper, 2700066J21Rik antikoerper, JsdX antikoerper, NY-CO-16 antikoerper, T25628 antikoerper, mKIAA0266 antikoerper, UTP14C antikoerper, UTP14A antikoerper, utp14a antikoerper, UTP14A, small subunit processome component antikoerper, UTP14A small subunit processome component antikoerper, UTP14, U3 small nucleolar ribonucleoprotein, homolog A-like antikoerper, U3 small nucleolar RNA-associated protein 14 homolog A antikoerper, UTP14A, small subunit processome component L homeolog antikoerper, UTP14A antikoerper, Utp14a antikoerper, LOC505600 antikoerper, LOC100083222 antikoerper, utp14a.L antikoerper
- Hintergrund
- This gene encodes a member of the uridine triphosphate 14 family. As an essential component of a large ribonucleoprotein complex bound to the U3 small nucleolar RNA, the encoded protein is involved in ribosome biogenesis and 18S rRNA synthesis. An autosomal retrotransposed copy of this X-linked gene exists on chromosome 13. Alternative splicing results in multiple transcript variants.
- Molekulargewicht
- 88 kDa (MW of target protein)
-