ATPAF1 Antikörper (N-Term)
-
- Target Alle ATPAF1 Antikörper anzeigen
- ATPAF1 (ATP Synthase Mitochondrial F1 Complex Assembly Factor 1 (ATPAF1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ATPAF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ATPAF1 antibody was raised against the N terminal of ATPAF1
- Aufreinigung
- Affinity purified
- Immunogen
- ATPAF1 antibody was raised using the N terminal of ATPAF1 corresponding to a region with amino acids GLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKI
- Top Product
- Discover our top product ATPAF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ATPAF1 Blocking Peptide, catalog no. 33R-3393, is also available for use as a blocking control in assays to test for specificity of this ATPAF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATPAF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATPAF1 (ATP Synthase Mitochondrial F1 Complex Assembly Factor 1 (ATPAF1))
- Andere Bezeichnung
- ATPAF1 (ATPAF1 Produkte)
- Hintergrund
- This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.
- Molekulargewicht
- 29 kDa (MW of target protein)
-