ATPAF1 Antikörper (N-Term)

Produktnummer ABIN633038

Produktdetails anti-ATPAF1 Antikörper

Target: ATPAF1 (ATP Synthase Mitochondrial F1 Complex Assembly Factor 1 (ATPAF1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATPAF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATPAF1 antibody was raised against the N terminal of ATPAF1

Aufreinigung: Affinity purified

Immunogen: ATPAF1 antibody was raised using the N terminal of ATPAF1 corresponding to a region with amino acids GLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATPAF1 Blocking Peptide, catalog no. 33R-3393, is also available for use as a blocking control in assays to test for specificity of this ATPAF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATPAF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATPAF1

Target: ATPAF1 (ATP Synthase Mitochondrial F1 Complex Assembly Factor 1 (ATPAF1))

Andere Bezeichnung: ATPAF1 (ATPAF1 Produkte)

Synonyme: ATPAF1 antikoerper, T14G11.17 antikoerper, T14G11_17 antikoerper, ATP11 antikoerper, ATP11p antikoerper, 6330547J17Rik antikoerper, AI593252 antikoerper, id:ibd1136 antikoerper, si:dkey-171o17.2 antikoerper, zgc:110583 antikoerper, ATP synthase mitochondrial F1 complex assembly factor 1 antikoerper, ATP synthase F1 complex assembly factor antikoerper, Atpaf1 antikoerper, ATPAF1 antikoerper, AT2G34050 antikoerper, atpaf1 antikoerper

Hintergrund: This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.

Molekulargewicht: 29 kDa (MW of target protein)