KLHL2 Antikörper
-
- Target Alle KLHL2 Antikörper anzeigen
- KLHL2 (Kelch-Like 2, Mayven (KLHL2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KLHL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- KLHL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVN
- Top Product
- Discover our top product KLHL2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KLHL2 Blocking Peptide, catalog no. 33R-9385, is also available for use as a blocking control in assays to test for specificity of this KLHL2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLHL2 (Kelch-Like 2, Mayven (KLHL2))
- Andere Bezeichnung
- KLHL2 (KLHL2 Produkte)
- Synonyme
- 6030411N21Rik antikoerper, ABP-KELCH antikoerper, AU020744 antikoerper, Mav antikoerper, mKIAA4249 antikoerper, MAV antikoerper, MAYVEN antikoerper, kelch-like family member 2 antikoerper, kelch like family member 2 antikoerper, kelch-like 2, Mayven antikoerper, Klhl2 antikoerper, KLHL2 antikoerper
- Hintergrund
- KLHL2 may play a role in organizing the actin cytoskeleton of the brain cells.
- Molekulargewicht
- 66 kDa (MW of target protein)
-