PNKP Antikörper (N-Term)

Produktnummer ABIN633050

Produktdetails anti-PNKP Antikörper

Target: PNKP (Polynucleotide Kinase 3'-Phosphatase (PNKP))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PNKP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PNKP antibody was raised against the N terminal of PNKP

Aufreinigung: Affinity purified

Immunogen: PNKP antibody was raised using the N terminal of PNKP corresponding to a region with amino acids MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PNKP Blocking Peptide, catalog no. 33R-6026, is also available for use as a blocking control in assays to test for specificity of this PNKP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNKP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PNKP

Target: PNKP (Polynucleotide Kinase 3'-Phosphatase (PNKP))

Andere Bezeichnung: PNKP (PNKP Produkte)

Hintergrund: This locus represents a gene involved in DNA repair. In response to ionizing radiation or oxidative damage, the protein encoded by this locus catalyzes 5' phosphorylation and 3' dephosphorylation of nucleic acids. Mutations at this locus have been associated with microcephaly, seizures, and developmental delay.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: DNA Reparatur, Nucleotide Phosphorylation