CRLF2 Antikörper (Middle Region)
-
- Target Alle CRLF2 Antikörper anzeigen
- CRLF2 (Cytokine Receptor-Like Factor 2 (CRLF2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CRLF2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CRLF2 antibody was raised against the middle region of CRLF2
- Aufreinigung
- Affinity purified
- Immunogen
- CRLF2 antibody was raised using the middle region of CRLF2 corresponding to a region with amino acids FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF
- Top Product
- Discover our top product CRLF2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CRLF2 Blocking Peptide, catalog no. 33R-3132, is also available for use as a blocking control in assays to test for specificity of this CRLF2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRLF2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRLF2 (Cytokine Receptor-Like Factor 2 (CRLF2))
- Andere Bezeichnung
- CRLF2 (CRLF2 Produkte)
- Synonyme
- CRLF2 antikoerper, CRL2 antikoerper, CRLF2Y antikoerper, TSLPR antikoerper, CRLM2 antikoerper, Ly114 antikoerper, Tpte2 antikoerper, Tslpr antikoerper, Crl2 antikoerper, cytokine receptor like factor 2 antikoerper, cytokine receptor-like factor 2 antikoerper, CRLF2 antikoerper, Crlf2 antikoerper
- Hintergrund
- Cytokine signals are mediated through specific receptor complexes, the components of which are mostly members of the type I cytokine receptor family. Type I cytokine receptors share conserved structural features in their extracellular domain. Receptor complexes are typically heterodimeric, consisting of alpha chains, which provide ligand specificity, and beta (or gamma) chains, which are required for the formation of high-affinity binding sites and signal transduction.
- Molekulargewicht
- 29 kDa (MW of target protein)
-