UGGT1 Antikörper (Middle Region)
-
- Target Alle UGGT1 Antikörper anzeigen
- UGGT1 (UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UGGT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UGCGL1 antibody was raised against the middle region of µgCGL1
- Aufreinigung
- Affinity purified
- Immunogen
- UGCGL1 antibody was raised using the middle region of µgCGL1 corresponding to a region with amino acids AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE
- Top Product
- Discover our top product UGGT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UGCGL1 Blocking Peptide, catalog no. 33R-1061, is also available for use as a blocking control in assays to test for specificity of this µgCGL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCGL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UGGT1 (UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1))
- Andere Bezeichnung
- UGCGL1 (UGGT1 Produkte)
- Synonyme
- UGCGL1 antikoerper, ugcgl1 antikoerper, uggt2 antikoerper, 0910001L17Rik antikoerper, A930007H10Rik antikoerper, AA589501 antikoerper, AI414429 antikoerper, AI448372 antikoerper, C820010P03Rik antikoerper, GT antikoerper, UGT1 antikoerper, Ugcgl1 antikoerper, Uggt antikoerper, rUGT1 antikoerper, HUGT1 antikoerper, EMS-mutagenized bri1 suppressor 1 antikoerper, F3I17.13 antikoerper, F3I17_13 antikoerper, PRIORITY IN SWEET LIFE 2 antikoerper, PSL2 antikoerper, UDP-GLUCOSE:GLYCOPROTEIN GLUCOSYLTRANSFERASE antikoerper, UGGT antikoerper, UDP-glucose glycoprotein glucosyltransferase 1 antikoerper, UDP-glucose glycoprotein glucosyltransferase 1 L homeolog antikoerper, UDP-glucose:glycoprotein glucosyltransferase 1 antikoerper, EMS-MUTAGENIZED BRI1 SUPPRESSOR 1 antikoerper, UGGT1 antikoerper, uggt1.L antikoerper, uggt1 antikoerper, LOC100545947 antikoerper, Uggt1 antikoerper, EBS1 antikoerper
- Hintergrund
- UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.
- Molekulargewicht
- 175 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response
-