EXOC8 Antikörper (N-Term)
-
- Target Alle EXOC8 (EXO84) Antikörper anzeigen
- EXOC8 (EXO84) (Exocyst Complex Component 8 (EXO84))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EXOC8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EXOC8 antibody was raised against the N terminal of EXOC8
- Aufreinigung
- Affinity purified
- Immunogen
- EXOC8 antibody was raised using the N terminal of EXOC8 corresponding to a region with amino acids MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQA
- Top Product
- Discover our top product EXO84 Primärantikörper
-
anti-Exocyst Complex Component 8 (EXO84) (AA 508-725) antibody
EXO84 Reaktivität: Human ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Exocyst Complex Component 8 (EXO84) (AA 360-389) antibodyEXO84 Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal RB24184 unconjugated
anti-Exocyst Complex Component 8 (EXO84) (N-Term) antibodyEXO84 Reaktivität: Human, Maus, Pferd, Rind (Kuh), Ratte, Hund, Meerschweinchen, Zebrafisch (Danio rerio), Affe, Huhn, Xenopus laevis, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
anti-Exocyst Complex Component 8 (EXO84) (N-Term) antibodyEXO84 Reaktivität: Human, Maus, Pferd, Rind (Kuh), Ratte, Hund, Meerschweinchen, Zebrafisch (Danio rerio), Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EXOC8 Blocking Peptide, catalog no. 33R-5702, is also available for use as a blocking control in assays to test for specificity of this EXOC8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EXOC8 (EXO84) (Exocyst Complex Component 8 (EXO84))
- Andere Bezeichnung
- EXOC8 (EXO84 Produkte)
- Synonyme
- EXOC8 antikoerper, zgc:162287 antikoerper, EXO84 antikoerper, Exo84p antikoerper, SEC84 antikoerper, AI414418 antikoerper, R74783 antikoerper, Exo84 antikoerper, exocyst complex component 8 antikoerper, exocyst complex component 8 S homeolog antikoerper, EXOC8 antikoerper, exoc8 antikoerper, Tsp_09714 antikoerper, Exoc8 antikoerper, exoc8.S antikoerper
- Hintergrund
- EXOC8 is the component of the exocyst complex involved in the docking of exocystic vesicles with fusion sites on the plasma membrane.
- Molekulargewicht
- 82 kDa (MW of target protein)
- Pathways
- Peptide Hormone Metabolism
-
