RAB39 Antikörper (N-Term)

Produktnummer ABIN633072

Produktdetails anti-RAB39 Antikörper

Target: RAB39 (RAB39, Member RAS Oncogene Family (RAB39))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB39 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RAB39 antibody was raised against the N terminal of RAB39

Aufreinigung: Affinity purified

Immunogen: RAB39 antibody was raised using the N terminal of RAB39 corresponding to a region with amino acids METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB39 Blocking Peptide, catalog no. 33R-5969, is also available for use as a blocking control in assays to test for specificity of this RAB39 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB39 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB39

Target: RAB39 (RAB39, Member RAS Oncogene Family (RAB39))

Andere Bezeichnung: RAB39 (RAB39 Produkte)

Synonyme: C230094F14Rik antikoerper, Rab39a antikoerper, RAB39, member RAS oncogene family antikoerper, Rab39 antikoerper

Hintergrund: RAB39 may be involved in vesicular trafficking.

Molekulargewicht: 25 kDa (MW of target protein)