CPLX2 Antikörper (N-Term)
-
- Target Alle CPLX2 Antikörper anzeigen
- CPLX2 (Complexin 2 (CPLX2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CPLX2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Complexin 2 antibody was raised against the N terminal of CPLX2
- Aufreinigung
- Affinity purified
- Immunogen
- Complexin 2 antibody was raised using the N terminal of CPLX2 corresponding to a region with amino acids MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA
- Top Product
- Discover our top product CPLX2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Complexin 2 Blocking Peptide, catalog no. 33R-5832, is also available for use as a blocking control in assays to test for specificity of this Complexin 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPLX2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CPLX2 (Complexin 2 (CPLX2))
- Andere Bezeichnung
- Complexin 2 (CPLX2 Produkte)
- Hintergrund
- Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene.
- Molekulargewicht
- 15 kDa (MW of target protein)
- Pathways
- Synaptic Vesicle Exocytosis
-