RABEPK Antikörper (N-Term)
-
- Target Alle RABEPK Antikörper anzeigen
- RABEPK (Rab9 Effector Protein with Kelch Motifs (RABEPK))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RABEPK Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RABEPK antibody was raised against the N terminal of RABEPK
- Aufreinigung
- Affinity purified
- Immunogen
- RABEPK antibody was raised using the N terminal of RABEPK corresponding to a region with amino acids MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKV
- Top Product
- Discover our top product RABEPK Primärantikörper
-
anti-Rab9 Effector Protein with Kelch Motifs (RABEPK) antibody
RABEPK Reaktivität: Human WB, ICC, IHC (p), IF, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Rab9 Effector Protein with Kelch Motifs (RABEPK) antibodyRABEPK Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Rab9 Effector Protein with Kelch Motifs (RABEPK) (AA 273-372) antibodyRABEPK Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 4C9 unconjugated
anti-Rab9 Effector Protein with Kelch Motifs (RABEPK) (AA 51-150) antibodyRABEPK Reaktivität: Maus WB, ELISA, IF (cc), IF (p), ICC, IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Rab9 Effector Protein with Kelch Motifs (RABEPK) (AA 303-331), (C-Term) antibodyRABEPK Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB40744 unconjugated
anti-Rab9 Effector Protein with Kelch Motifs (RABEPK) antibodyRABEPK Reaktivität: Human WB Wirt: Kaninchen Monoclonal unconjugated
anti-Rab9 Effector Protein with Kelch Motifs (RABEPK) (AA 35-84) antibodyRABEPK Reaktivität: Human, Schwein, Kaninchen, Hund, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Rab9 Effector Protein with Kelch Motifs (RABEPK) (N-Term) antibodyRABEPK Reaktivität: Human, Schwein, Kaninchen, Rind (Kuh), Pferd, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
anti-Rab9 Effector Protein with Kelch Motifs (RABEPK) (N-Term) antibodyRABEPK Reaktivität: Human, Maus, Ratte, Schwein, Kaninchen, Rind (Kuh), Pferd, Hund, Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RABEPK Blocking Peptide, catalog no. 33R-6159, is also available for use as a blocking control in assays to test for specificity of this RABEPK antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABEPK antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RABEPK (Rab9 Effector Protein with Kelch Motifs (RABEPK))
- Andere Bezeichnung
- RABEPK (RABEPK Produkte)
- Synonyme
- RAB9P40 antikoerper, bA65N13.1 antikoerper, p40 antikoerper, 8430412M01Rik antikoerper, 9530020D24Rik antikoerper, AV073337 antikoerper, C87311 antikoerper, Rab9p40 antikoerper, 9530020d24rik antikoerper, RGD1310612 antikoerper, Rab9 effector protein with kelch motifs antikoerper, Rab9 effector protein with kelch motifs L homeolog antikoerper, RABEPK antikoerper, Rabepk antikoerper, rabepk.L antikoerper, rabepk antikoerper
- Hintergrund
- RABEPK is a rab9 effector required for endosome to trans-Golgi network (TGN) transport.
- Molekulargewicht
- 40 kDa (MW of target protein)
-
