TUBB4 Antikörper (N-Term)

Produktnummer ABIN633077

Produktdetails anti-TUBB4 Antikörper

Target: TUBB4 (TUBB4A) (Tubulin beta 4a (TUBB4A))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TUBB4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Beta Tubulin 4 antibody was raised against the N terminal of TUBB4

Aufreinigung: Affinity purified

Immunogen: Beta Tubulin 4 antibody was raised using the N terminal of TUBB4 corresponding to a region with amino acids TYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Beta Tubulin 4 Blocking Peptide, catalog no. 33R-9390, is also available for use as a blocking control in assays to test for specificity of this Beta Tubulin 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBB4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TUBB4

Target: TUBB4 (TUBB4A) (Tubulin beta 4a (TUBB4A))

Abstract: TUBB4A Produkte

Hintergrund: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Molekulargewicht: 49 kDa (MW of target protein)