TUBB4 Antikörper (N-Term)

Produktnummer ABIN633077

Produktdetails anti-TUBB4 Antikörper

Target: TUBB4 (TUBB4A) (Tubulin beta 4a (TUBB4A))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TUBB4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Beta Tubulin 4 antibody was raised against the N terminal of TUBB4

Aufreinigung: Affinity purified

Immunogen: Beta Tubulin 4 antibody was raised using the N terminal of TUBB4 corresponding to a region with amino acids TYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Beta Tubulin 4 Blocking Peptide, catalog no. 33R-9390, is also available for use as a blocking control in assays to test for specificity of this Beta Tubulin 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBB4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TUBB4

Target: TUBB4 (TUBB4A) (Tubulin beta 4a (TUBB4A))

Abstract: TUBB4A Produkte

Synonyme: DYT4 antikoerper, HLD6 antikoerper, TUBB4 antikoerper, TUBB5 antikoerper, beta-5 antikoerper, AI325297 antikoerper, M(beta)4 antikoerper, Tubb antikoerper, Tubb4 antikoerper, betatub56d antikoerper, tubb2 antikoerper, tubb2c antikoerper, tubb4 antikoerper, tubb4a antikoerper, tubb5 antikoerper, tubulin beta 4A class IVa antikoerper, tubulin, beta 4A class IVA antikoerper, tubulin, beta 4A class IVa antikoerper, tubulin beta 4B class IVb L homeolog antikoerper, Tubulin beta-4A chain antikoerper, tubulin beta 4A class IVa S homeolog antikoerper, TUBB4A antikoerper, Tubb4a antikoerper, tubb4b.L antikoerper, tubb4a.S antikoerper

Hintergrund: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Molekulargewicht: 49 kDa (MW of target protein)