RAB11FIP2 Antikörper
-
- Target Alle RAB11FIP2 Antikörper anzeigen
- RAB11FIP2 (RAB11 Family Interacting Protein 2 (Class I) (RAB11FIP2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAB11FIP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RAB11 FIP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF
- Top Product
- Discover our top product RAB11FIP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAB11FIP2 Blocking Peptide, catalog no. 33R-5150, is also available for use as a blocking control in assays to test for specificity of this RAB11FIP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB10 IP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAB11FIP2 (RAB11 Family Interacting Protein 2 (Class I) (RAB11FIP2))
- Andere Bezeichnung
- RAB11FIP2 (RAB11FIP2 Produkte)
- Synonyme
- RGD1308538 antikoerper, Rab11-FIP2 antikoerper, nRip11 antikoerper, 4930470G04Rik antikoerper, A830046J09Rik antikoerper, AW558126 antikoerper, Nrip11 antikoerper, RAB11 family interacting protein 2 antikoerper, RAB11 family interacting protein 2 (class I) antikoerper, Rab11fip2 antikoerper, RAB11FIP2 antikoerper
- Hintergrund
- RAB11FIP2 is a Rab11 effector protein acting in the regulation of the transport of vesicles from the endosomal recycling compartment (ERC) to the plasma membrane.RAB11FIP2 is also involved in receptor-mediated endocytosis and membrane trafficking of recycling endosomes, probably originating from clathrin-coated vesicles. Binds preferentially to phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and phosphatidic acid (PA).
- Molekulargewicht
- 58 kDa (MW of target protein)
- Pathways
- Hormone Transport, Carbohydrate Homeostasis
-