STK38L Antikörper (Middle Region)
-
- Target Alle STK38L Antikörper anzeigen
- STK38L (serine/threonine Kinase 38 Like (STK38L))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STK38L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- STK38 L antibody was raised against the middle region of STK38
- Aufreinigung
- Affinity purified
- Immunogen
- STK38 L antibody was raised using the middle region of STK38 corresponding to a region with amino acids PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK
- Top Product
- Discover our top product STK38L Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
STK38L Blocking Peptide, catalog no. 33R-6952, is also available for use as a blocking control in assays to test for specificity of this STK38L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK30 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STK38L (serine/threonine Kinase 38 Like (STK38L))
- Andere Bezeichnung
- STK38L (STK38L Produkte)
- Synonyme
- RGD1564793 antikoerper, NDR2 antikoerper, 4930473A22Rik antikoerper, B230328I19 antikoerper, Ndr2 antikoerper, Ndr54 antikoerper, serine/threonine kinase 38 like antikoerper, Stk38l antikoerper, STK38L antikoerper
- Hintergrund
- STK38L is involved in the regulation of structural processes in differentiating and mature neuronal cells.
- Molekulargewicht
- 54 kDa (MW of target protein)
-