Glycerol Kinase Antikörper (Middle Region)
-
- Target Alle Glycerol Kinase (GK) Antikörper anzeigen
- Glycerol Kinase (GK)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Glycerol Kinase Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GK antibody was raised against the middle region of GK
- Aufreinigung
- Affinity purified
- Immunogen
- GK antibody was raised using the middle region of GK corresponding to a region with amino acids MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS
- Top Product
- Discover our top product GK Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GK Blocking Peptide, catalog no. 33R-5595, is also available for use as a blocking control in assays to test for specificity of this GK antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GK antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Glycerol Kinase (GK)
- Andere Bezeichnung
- GK (GK Produkte)
- Synonyme
- GK1 antikoerper, GKD antikoerper, D930012N15Rik antikoerper, GK antikoerper, CG18374 antikoerper, Dmel\\CG18374 antikoerper, dGyk antikoerper, ASTP antikoerper, Gyk antikoerper, gk1 antikoerper, gk2 antikoerper, gkd antikoerper, gyk antikoerper, Gk antikoerper, BmGK antikoerper, DKFZp469P1225 antikoerper, glycerol kinase antikoerper, Glycerol kinase 1 antikoerper, glycerol kinase S homeolog antikoerper, putative glycerol kinase 3 antikoerper, ATP:glycerol 3-phosphotransferase; glycerokinase; GK antikoerper, Glycerol kinase antikoerper, Fanconi anemia core complex associated protein 100 antikoerper, GK antikoerper, Gk antikoerper, Gk1 antikoerper, gk.S antikoerper, LOC705001 antikoerper, glpK antikoerper, Spico_1557 antikoerper, Trebr_0397 antikoerper, Halhy_5315 antikoerper, gk antikoerper, FAAP100 antikoerper
- Hintergrund
- The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GkDa). Alternatively spliced transcript variants encoding different isoforms have been identified.
- Molekulargewicht
- 58 kDa (MW of target protein)
-