ARHGEF19 Antikörper

Produktnummer ABIN633111

Produktdetails anti-ARHGEF19 Antikörper

Target: ARHGEF19 (rho Guanine Nucleotide Exchange Factor (GEF) 19 (ARHGEF19))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARHGEF19 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ARHGEF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARHGEF19 Blocking Peptide, catalog no. 33R-7904, is also available for use as a blocking control in assays to test for specificity of this ARHGEF19 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGEF19 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARHGEF19

Target: ARHGEF19 (rho Guanine Nucleotide Exchange Factor (GEF) 19 (ARHGEF19))

Andere Bezeichnung: ARHGEF19 (ARHGEF19 Produkte)

Synonyme: WGEF antikoerper, 6030432F23 antikoerper, 6430573B13Rik antikoerper, Rho guanine nucleotide exchange factor 19 antikoerper, Rho guanine nucleotide exchange factor (GEF) 19 antikoerper, ARHGEF19 antikoerper, Arhgef19 antikoerper

Hintergrund: Guanine nucleotide exchange factors (GEFs) such as ARHGEF19 accelerate the GTPase activity of Rho GTPases.

Molekulargewicht: 89 kDa (MW of target protein)