NUBP1 Antikörper
-
- Target Alle NUBP1 Antikörper anzeigen
- NUBP1 (Nucleotide Binding Protein 1 (NUBP1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NUBP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NUBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKM
- Top Product
- Discover our top product NUBP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NUBP1 Blocking Peptide, catalog no. 33R-5911, is also available for use as a blocking control in assays to test for specificity of this NUBP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUBP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUBP1 (Nucleotide Binding Protein 1 (NUBP1))
- Andere Bezeichnung
- NUBP1 (NUBP1 Produkte)
- Synonyme
- DDBDRAFT_0169230 antikoerper, DDBDRAFT_0232424 antikoerper, DDB_0169230 antikoerper, DDB_0232424 antikoerper, NBP antikoerper, NBP1 antikoerper, nbp antikoerper, nbp1 antikoerper, nubp1 antikoerper, NBP 1 antikoerper, im:7144207 antikoerper, zgc:92138 antikoerper, nucleotide binding protein 1 antikoerper, nucleotide binding protein 1 (MinD homolog, E. coli) antikoerper, nucleotide binding protein 1 L homeolog antikoerper, nucleotide binding protein 1 S homeolog antikoerper, Nubp1 antikoerper, nubp1 antikoerper, NUBP1 antikoerper, nubp1.L antikoerper, nubp1.S antikoerper
- Hintergrund
- NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins.
- Molekulargewicht
- 34 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-