CCDC146 Antikörper (Middle Region)
-
- Target Alle CCDC146 Antikörper anzeigen
- CCDC146 (Coiled-Coil Domain Containing 146 (CCDC146))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CCDC146 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CCDC146 antibody was raised against the middle region of CCDC146
- Aufreinigung
- Affinity purified
- Immunogen
- CCDC146 antibody was raised using the middle region of CCDC146 corresponding to a region with amino acids KEIEKEWLKVLRDEEMHALAIAEKSQEFLEADNRQLPNGVYTTAEQRPNA
- Top Product
- Discover our top product CCDC146 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CCDC146 Blocking Peptide, catalog no. 33R-4337, is also available for use as a blocking control in assays to test for specificity of this CCDC146 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC146 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCDC146 (Coiled-Coil Domain Containing 146 (CCDC146))
- Andere Bezeichnung
- CCDC146 (CCDC146 Produkte)
- Synonyme
- coiled-coil domain containing 146 antikoerper, CCDC146 antikoerper, Ccdc146 antikoerper
- Hintergrund
- The function of CCDC146 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 113 kDa (MW of target protein)
-