RFTN2 Antikörper (N-Term)

Produktnummer ABIN633116

Produktdetails anti-RFTN2 Antikörper

Target: RFTN2 (Raftlin Family Member 2 (RFTN2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RFTN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RFTN2 antibody was raised against the N terminal of RFTN2

Aufreinigung: Affinity purified

Immunogen: RFTN2 antibody was raised using the N terminal of RFTN2 corresponding to a region with amino acids MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTLQASSN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RFTN2 Blocking Peptide, catalog no. 33R-6014, is also available for use as a blocking control in assays to test for specificity of this RFTN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFTN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RFTN2

Target: RFTN2 (Raftlin Family Member 2 (RFTN2))

Andere Bezeichnung: RFTN2 (RFTN2 Produkte)

Synonyme: RGD1307304 antikoerper, zgc:56544 antikoerper, wu:fi98e03 antikoerper, Raftlin-2 antikoerper, DKFZp459I212 antikoerper, C2orf11 antikoerper, 2700010E02Rik antikoerper, 3222401M22Rik antikoerper, raftlin family member 2 antikoerper, Rftn2 antikoerper, RFTN2 antikoerper, rftn2 antikoerper

Hintergrund: The function of the protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 56 kDa (MW of target protein)