RAPGEF3 Antikörper
-
- Target Alle RAPGEF3 Antikörper anzeigen
- RAPGEF3 (Rap Guanine Nucleotide Exchange Factor (GEF) 3 (RAPGEF3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAPGEF3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RAPGEF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME
- Top Product
- Discover our top product RAPGEF3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAPGEF3 Blocking Peptide, catalog no. 33R-8206, is also available for use as a blocking control in assays to test for specificity of this RAPGEF3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPGEF3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAPGEF3 (Rap Guanine Nucleotide Exchange Factor (GEF) 3 (RAPGEF3))
- Andere Bezeichnung
- RAPGEF3 (RAPGEF3 Produkte)
- Synonyme
- RAPGEF3 antikoerper, epac antikoerper, si:dkey-27m20.2 antikoerper, CAMP-GEFI antikoerper, EPAC antikoerper, EPAC1 antikoerper, HSU79275 antikoerper, bcm910 antikoerper, 2310016P22Rik antikoerper, 9330170P05Rik antikoerper, Epac antikoerper, Epac1 antikoerper, Rap guanine nucleotide exchange factor 3 antikoerper, Rap guanine nucleotide exchange factor 3 S homeolog antikoerper, Rap guanine nucleotide exchange factor (GEF) 3 antikoerper, RAPGEF3 antikoerper, rapgef3.S antikoerper, rapgef3 antikoerper, Rapgef3 antikoerper
- Hintergrund
- RAPGEF3 is a guanine nucleotide exchange factor (GEF) for RAP1A and RAP2A small GTPases that is activated by binding cAMP.
- Molekulargewicht
- 99 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-