TACC3 Antikörper (Middle Region)
-
- Target Alle TACC3 Antikörper anzeigen
- TACC3 (Transforming, Acidic Coiled-Coil Containing Protein 3 (TACC3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TACC3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TACC3 antibody was raised against the middle region of TACC3
- Aufreinigung
- Affinity purified
- Immunogen
- TACC3 antibody was raised using the middle region of TACC3 corresponding to a region with amino acids PGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDYLEQFGTSSFKES
- Top Product
- Discover our top product TACC3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TACC3 Blocking Peptide, catalog no. 33R-7132, is also available for use as a blocking control in assays to test for specificity of this TACC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TACC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TACC3 (Transforming, Acidic Coiled-Coil Containing Protein 3 (TACC3))
- Andere Bezeichnung
- TACC3 (TACC3 Produkte)
- Synonyme
- Aint antikoerper, C86661 antikoerper, Eric1 antikoerper, ERIC-1 antikoerper, ERIC1 antikoerper, maskin antikoerper, masking antikoerper, xmaskin antikoerper, transforming, acidic coiled-coil containing protein 3 antikoerper, transforming acidic coiled-coil containing protein 3 antikoerper, transforming acidic coiled-coil containing protein 3 S homeolog antikoerper, Tacc3 antikoerper, TACC3 antikoerper, tacc3.S antikoerper
- Hintergrund
- The function of this gene has not yet been determined, however, it is speculated that it may be involved in cell growth and differentiation. Expression of this gene is up-regulated in some cancer cell lines, and in embryonic day 15 in mice.
- Molekulargewicht
- 90 kDa (MW of target protein)
- Pathways
- Maintenance of Protein Location
-