TMEM139 Antikörper (N-Term)

Produktnummer ABIN633124

Produktdetails anti-TMEM139 Antikörper

Target: TMEM139 (Transmembrane Protein 139 (TMEM139))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM139 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM139 antibody was raised against the N terminal of TMEM139

Aufreinigung: Affinity purified

Immunogen: TMEM139 antibody was raised using the N terminal of TMEM139 corresponding to a region with amino acids ITPVAYFFLTLGGFFLFAYLLVRFLEWGLRSQLQSMQTESPGPSGNARDN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM139 Blocking Peptide, catalog no. 33R-4186, is also available for use as a blocking control in assays to test for specificity of this TMEM139 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM139 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM139

Target: TMEM139 (Transmembrane Protein 139 (TMEM139))

Andere Bezeichnung: TMEM139 (TMEM139 Produkte)

Synonyme: A930027H06Rik antikoerper, transmembrane protein 139 antikoerper, TMEM139 antikoerper, Tmem139 antikoerper

Hintergrund: The function of TMEM139 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 24 kDa (MW of target protein)