MAGEA5 Antikörper (N-Term)

Produktnummer ABIN633132

Produktdetails anti-MAGEA5 Antikörper

Target: MAGEA5 (Melanoma Antigen Family A, 5 (MAGEA5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAGEA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAGEA5 antibody was raised against the N terminal of MAGEA5

Aufreinigung: Affinity purified

Immunogen: MAGEA5 antibody was raised using the N terminal of MAGEA5 corresponding to a region with amino acids MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAGEA5 Blocking Peptide, catalog no. 33R-6458, is also available for use as a blocking control in assays to test for specificity of this MAGEA5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAGEA5

Target: MAGEA5 (Melanoma Antigen Family A, 5 (MAGEA5))

Andere Bezeichnung: MAGEA5 (MAGEA5 Produkte)

Synonyme: CT1.5 antikoerper, MAGE5 antikoerper, MAGEA4 antikoerper, Mage-a5 antikoerper, MAGE family member A5 antikoerper, melanoma antigen, family A, 5 antikoerper, MAGEA5 antikoerper, Magea5 antikoerper

Hintergrund: This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. This MAGEA gene encodes a protein that is C-terminally truncated compared to other family members, and this gene can be alternatively interpreted to be a pseudogene. The protein is represented in this Entrez Gene record in accordance with the assumed protein-coding status defined in the literature.

Molekulargewicht: 13 kDa (MW of target protein)