MEIOB Antikörper (Middle Region)
-
- Target Alle MEIOB Antikörper anzeigen
- MEIOB (Meiosis Specific with OB Domains (MEIOB))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MEIOB Antikörper ist unkonjugiert
- Applikation
- Western Blotting (WB)
- Spezifität
- C16 orf73 antibody was raised against the middle region of C16 rf73
- Aufreinigung
- Affinity purified
- Immunogen
- C16 orf73 antibody was raised using the middle region of C16 rf73 corresponding to a region with amino acids CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH
- Top Product
- Discover our top product MEIOB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C16orf73 Blocking Peptide, catalog no. 33R-1811, is also available for use as a blocking control in assays to test for specificity of this C16orf73 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf73 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MEIOB (Meiosis Specific with OB Domains (MEIOB))
- Andere Bezeichnung
- C16orf73 (MEIOB Produkte)
- Hintergrund
- C16orf73 may be involved in early meiosis.
- Molekulargewicht
- 22 kDa (MW of target protein)
-