MEIOB Antikörper (Middle Region)

Produktnummer ABIN633134

Produktdetails anti-MEIOB Antikörper

Target: MEIOB (Meiosis Specific with OB Domains (MEIOB))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MEIOB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C16 orf73 antibody was raised against the middle region of C16 rf73

Aufreinigung: Affinity purified

Immunogen: C16 orf73 antibody was raised using the middle region of C16 rf73 corresponding to a region with amino acids CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C16orf73 Blocking Peptide, catalog no. 33R-1811, is also available for use as a blocking control in assays to test for specificity of this C16orf73 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf73 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MEIOB

Target: MEIOB (Meiosis Specific with OB Domains (MEIOB))

Andere Bezeichnung: C16orf73 (MEIOB Produkte)

Synonyme: C16orf73 antikoerper, gs129 antikoerper, 4930528F23Rik antikoerper, MLZ-675 antikoerper, meiosis specific with OB domains antikoerper, MEIOB antikoerper, Meiob antikoerper

Hintergrund: C16orf73 may be involved in early meiosis.

Molekulargewicht: 22 kDa (MW of target protein)