GLIPR1L1 Antikörper (Middle Region)

Produktnummer ABIN633140

Produktdetails anti-GLIPR1L1 Antikörper

Target: GLIPR1L1 (GLI Pathogenesis-Related 1 Like 1 (GLIPR1L1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLIPR1L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GLIPR1 L1 antibody was raised against the middle region of GLIPR1 1

Aufreinigung: Affinity purified

Immunogen: GLIPR1 L1 antibody was raised using the middle region of GLIPR1 1 corresponding to a region with amino acids NMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLIPR1L1 Blocking Peptide, catalog no. 33R-6798, is also available for use as a blocking control in assays to test for specificity of this GLIPR1L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLIPR0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GLIPR1L1

Target: GLIPR1L1 (GLI Pathogenesis-Related 1 Like 1 (GLIPR1L1))

Andere Bezeichnung: GLIPR1L1 (GLIPR1L1 Produkte)

Synonyme: 1700011E04Rik antikoerper, ALKN2972 antikoerper, PRO7434 antikoerper, GLI pathogenesis-related 1 like 1 antikoerper, GLI pathogenesis related 1 like 1 antikoerper, Glipr1l1 antikoerper, GLIPR1L1 antikoerper

Hintergrund: GLIPR1L1 is a novel testis-specific CAP protein and is presented to the acrosomal cap following in vitro capacitation.

Molekulargewicht: 26 kDa (MW of target protein)