NRBF2 Antikörper (N-Term)

Produktnummer ABIN633155

Produktdetails anti-NRBF2 Antikörper

Target: NRBF2 (Nuclear Receptor Binding Factor 2 (NRBF2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NRBF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NRBF2 antibody was raised against the N terminal of NRBF2

Aufreinigung: Affinity purified

Immunogen: NRBF2 antibody was raised using the N terminal of NRBF2 corresponding to a region with amino acids KKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NRBF2 Blocking Peptide, catalog no. 33R-4448, is also available for use as a blocking control in assays to test for specificity of this NRBF2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRBF2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NRBF2

Target: NRBF2 (Nuclear Receptor Binding Factor 2 (NRBF2))

Andere Bezeichnung: NRBF2 (NRBF2 Produkte)

Synonyme: COPR1 antikoerper, COPR2 antikoerper, NRBF-2 antikoerper, nuclear receptor binding factor 2 antikoerper, NRBF2 antikoerper, Nrbf2 antikoerper

Hintergrund: NRBF2 may modulate transcriptional activation by target nuclear receptors.

Molekulargewicht: 32 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway