CRNN Antikörper (Middle Region)
-
- Target Alle CRNN Antikörper anzeigen
- CRNN (Cornulin (CRNN))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CRNN Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Cornulin antibody was raised against the middle region of CRNN
- Aufreinigung
- Affinity purified
- Immunogen
- Cornulin antibody was raised using the middle region of CRNN corresponding to a region with amino acids GDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG
- Top Product
- Discover our top product CRNN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cornulin Blocking Peptide, catalog no. 33R-3210, is also available for use as a blocking control in assays to test for specificity of this Cornulin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRNN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRNN (Cornulin (CRNN))
- Andere Bezeichnung
- Cornulin (CRNN Produkte)
- Synonyme
- C1orf10 antikoerper, DRC1 antikoerper, PDRC1 antikoerper, SEP53 antikoerper, RGD1311778 antikoerper, Gm1015 antikoerper, cornulin antikoerper, CRNN antikoerper, Crnn antikoerper, LOC100359146 antikoerper
- Hintergrund
- This gene encodes a member of the 'fused gene' family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threonine-rich 60 amino acid repeats in its C-terminus. This gene, also known as squamous epithelial heat shock protein 53, may play a role in the mucosal/epithelial immune response and epidermal differentiation.
- Molekulargewicht
- 52 kDa (MW of target protein)
-