-
- Target Alle PAGE4 Antikörper anzeigen
- PAGE4 (P Antigen Family, Member 4 (Prostate Associated) (PAGE4))
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PAGE4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PAGE4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ
- Top Product
- Discover our top product PAGE4 Primärantikörper
-
anti-P Antigen Family, Member 4 (Prostate Associated) (PAGE4) (AA 1-102) antibody
PAGE4 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 7C3 unconjugated
anti-P Antigen Family, Member 4 (Prostate Associated) (PAGE4) (AA 45-102) antibodyPAGE4 Reaktivität: Human IF (cc), IF (p), ELISA, IHC (fro), IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-P Antigen Family, Member 4 (Prostate Associated) (PAGE4) (AA 1-102) antibodyPAGE4 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-P Antigen Family, Member 4 (Prostate Associated) (PAGE4) (C-Term) antibodyPAGE4 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PAGE4 Blocking Peptide, catalog no. 33R-7259, is also available for use as a blocking control in assays to test for specificity of this PAGE4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAGE4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAGE4 (P Antigen Family, Member 4 (Prostate Associated) (PAGE4))
- Andere Bezeichnung
- PAGE4 (PAGE4 Produkte)
- Synonyme
- CT16.7 antikoerper, GAGE-9 antikoerper, GAGEC1 antikoerper, JM-27 antikoerper, PAGE-1 antikoerper, PAGE-4 antikoerper, PAGE family member 4 antikoerper, PAGE4 antikoerper
- Hintergrund
- This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens.
- Molekulargewicht
- 11 kDa (MW of target protein)
-
Sie sind hier:
