OST alpha Antikörper (Middle Region)
-
- Target Alle OST alpha (OSTALPHA) Antikörper anzeigen
- OST alpha (OSTALPHA) (Organic Solute Transporter alpha (OSTALPHA))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser OST alpha Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- OSTalpha antibody was raised against the middle region of OSTalpha
- Aufreinigung
- Affinity purified
- Immunogen
- OSTalpha antibody was raised using the middle region of OSTalpha corresponding to a region with amino acids LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS
- Top Product
- Discover our top product OSTALPHA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
OSTalpha Blocking Peptide, catalog no. 33R-5169, is also available for use as a blocking control in assays to test for specificity of this OSTalpha antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSTalpha antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OST alpha (OSTALPHA) (Organic Solute Transporter alpha (OSTALPHA))
- Andere Bezeichnung
- OSTalpha (OSTALPHA Produkte)
- Synonyme
- Osta antikoerper, Ostalpha antikoerper, RGD1311100 antikoerper, OSTA antikoerper, OSTalpha antikoerper, AV001382 antikoerper, AW261577 antikoerper, D630035O19Rik antikoerper, OSTALPHA antikoerper, solute carrier family 51, alpha subunit antikoerper, solute carrier family 51 alpha subunit antikoerper, Slc51a antikoerper, SLC51A antikoerper
- Hintergrund
- OSTalpha is essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. OSTalpha efficiently transports the major species of bile acids.
- Molekulargewicht
- 38 kDa (MW of target protein)
-