PRKACA Antikörper (N-Term)
-
- Target Alle PRKACA Antikörper anzeigen
- PRKACA (Protein Kinase A, alpha (PRKACA))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRKACA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRKACA antibody was raised against the N terminal of PRKACA
- Aufreinigung
- Affinity purified
- Immunogen
- PRKACA antibody was raised using the N terminal of PRKACA corresponding to a region with amino acids MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV
- Top Product
- Discover our top product PRKACA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRKACA Blocking Peptide, catalog no. 33R-5754, is also available for use as a blocking control in assays to test for specificity of this PRKACA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKACA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRKACA (Protein Kinase A, alpha (PRKACA))
- Andere Bezeichnung
- PRKACA (PRKACA Produkte)
- Synonyme
- PKACA antikoerper, Calpha antikoerper, Cs-PKA antikoerper, PKCA1 antikoerper, PKA antikoerper, PKCD antikoerper, Pkaca antikoerper, zgc:158799 antikoerper, protein kinase cAMP-activated catalytic subunit alpha antikoerper, protein kinase, cAMP dependent, catalytic, alpha antikoerper, cAMP-dependent protein kinase catalytic subunit antikoerper, protein kinase, cAMP-dependent, catalytic, alpha, genome duplicate a antikoerper, PRKACA antikoerper, Prkaca antikoerper, kin-1 antikoerper, prkacaa antikoerper
- Hintergrund
- CAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- NF-kappaB Signalweg, Hedgehog Signalweg, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Thyroid Hormone Synthesis, Carbohydrate Homeostasis, Myometrial Relaxation and Contraction, M Phase, G-protein mediated Events, Signaling Events mediated by VEGFR1 and VEGFR2, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, VEGFR1 Specific Signals, Lipid Metabolism, SARS-CoV-2 Protein Interaktom, Phosphorylierungen bei SARS-CoV-2 Infektion
-