DOK6 Antikörper (Middle Region)
-
- Target Alle DOK6 Antikörper anzeigen
- DOK6 (Docking Protein 6 (DOK6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DOK6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DOK6 antibody was raised against the middle region of DOK6
- Aufreinigung
- Affinity purified
- Immunogen
- DOK6 antibody was raised using the middle region of DOK6 corresponding to a region with amino acids IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI
- Top Product
- Discover our top product DOK6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DOK6 Blocking Peptide, catalog no. 33R-4227, is also available for use as a blocking control in assays to test for specificity of this DOK6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOK6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DOK6 (Docking Protein 6 (DOK6))
- Andere Bezeichnung
- DOK6 (DOK6 Produkte)
- Synonyme
- DOK5L antikoerper, HsT3226 antikoerper, Dok-6 antikoerper, RGD1564376 antikoerper, docking protein 6 antikoerper, DOK6 antikoerper, Dok6 antikoerper
- Hintergrund
- DOK6 is a member of the DOK family of intracellular adaptors that play a role in the RET signaling cascade.
- Molekulargewicht
- 38 kDa (MW of target protein)
-