NAA15 Antikörper (Middle Region)

Produktnummer ABIN633171

Produktdetails anti-NAA15 Antikörper

Target: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NAA15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NARG1 antibody was raised against the middle region of NARG1

Aufreinigung: Affinity purified

Immunogen: NARG1 antibody was raised using the middle region of NARG1 corresponding to a region with amino acids PPVFNTLRSLYKDKEKVAIIEELVVGYETSLKSCRLFNPNDDGKEEPPTT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NARG1 Blocking Peptide, catalog no. 33R-7288, is also available for use as a blocking control in assays to test for specificity of this NARG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NARG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NAA15

Target: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Andere Bezeichnung: NARG1 (NAA15 Produkte)

Synonyme: Ga19 antikoerper, NARG1 antikoerper, NATH antikoerper, TBDN100 antikoerper, 5730450D16Rik antikoerper, 6330400I15 antikoerper, ASTBDN antikoerper, Narg1 antikoerper, Tbdn-1 antikoerper, mNAT1 antikoerper, narg1l antikoerper, N(alpha)-acetyltransferase 15, NatA auxiliary subunit antikoerper, N(alpha)-acetyltransferase 15, NatA auxiliary subunit S homeolog antikoerper, NAA15 antikoerper, Naa15 antikoerper, naa15.S antikoerper

Hintergrund: The ARD1A-NARG1 complex displays alpha (N-terminal) acetyltransferase activity that may be important for vascular, hematopoietic and neuronal growth and development. NARG1 is required to control retinal neovascularization in adult ocular endothelial cells. In complex with G22P1 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter.

Molekulargewicht: 101 kDa (MW of target protein)