NAA15 Antikörper (N-Term)
-
- Target Alle NAA15 Antikörper anzeigen
- NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NAA15 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NARG1 antibody was raised against the N terminal of NARG1
- Aufreinigung
- Affinity purified
- Immunogen
- NARG1 antibody was raised using the N terminal of NARG1 corresponding to a region with amino acids LRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSEL
- Top Product
- Discover our top product NAA15 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NARG1 Blocking Peptide, catalog no. 33R-5374, is also available for use as a blocking control in assays to test for specificity of this NARG1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NARG1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))
- Andere Bezeichnung
- NARG1 (NAA15 Produkte)
- Hintergrund
- The ARD1A-NARG1 complex displays alpha (N-terminal) acetyltransferase activity that may be important for vascular, hematopoietic and neuronal growth and development. NARG1 is required to control retinal neovascularization in adult ocular endothelial cells. In complex with G22P1 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter.
- Molekulargewicht
- 101 kDa (MW of target protein)
-