MMP19 Antikörper (N-Term)

Produktnummer ABIN633173

Produktdetails anti-MMP19 Antikörper

Target: MMP19 (Matrix Metallopeptidase 19 (MMP19))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MMP19 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: MMP19 antibody was raised against the N terminal of MMP19

Aufreinigung: Affinity purified

Immunogen: MMP19 antibody was raised using the N terminal of MMP19 corresponding to a region with amino acids ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWR

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MMP19 Blocking Peptide, catalog no. 33R-1365, is also available for use as a blocking control in assays to test for specificity of this MMP19 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP19 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MMP19

Target: MMP19 (Matrix Metallopeptidase 19 (MMP19))

Andere Bezeichnung: MMP19 (MMP19 Produkte)

Synonyme: mmp18 antikoerper, mmp-18 antikoerper, mmp-19 antikoerper, col4 antikoerper, MMP18 antikoerper, RASI-1 antikoerper, matrix metallopeptidase 19 antikoerper, matrix metallopeptidase 1 S homeolog antikoerper, mmp19 antikoerper, mmp1.S antikoerper, MMP19 antikoerper, Mmp19 antikoerper

Hintergrund: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling. They are also involved in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The function of MMP-19 has not been determined. This gene corresponding to this protein was previously referred to as MMP18 but has been renamed matrix metalloproteinase 19 (MMP19). Multiple transcript variants encoding distict isoforms have been identified for this gene.

Molekulargewicht: 56 kDa (MW of target protein)