FGF2 Antikörper
-
- Target Alle FGF2 Antikörper anzeigen
- FGF2 (Fibroblast Growth Factor 2 (Basic) (FGF2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FGF2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- FGF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
- Top Product
- Discover our top product FGF2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FGF2 Blocking Peptide, catalog no. 33R-8018, is also available for use as a blocking control in assays to test for specificity of this FGF2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGF2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FGF2 (Fibroblast Growth Factor 2 (Basic) (FGF2))
- Andere Bezeichnung
- FGF2 (FGF2 Produkte)
- Synonyme
- BFGF antikoerper, FGF-2 antikoerper, FGFB antikoerper, HBGF-2 antikoerper, Fgf-2 antikoerper, Fgfb antikoerper, bFGF antikoerper, fibroblast growth factor 2 antikoerper, fibroblast growth factor 2 (basic) antikoerper, FGF2 antikoerper, Fgf2 antikoerper, fgf2 antikoerper
- Hintergrund
- The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.
- Molekulargewicht
- 31 kDa (MW of target protein)
- Pathways
- RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, C21-Steroid Hormone Metabolic Process, Inositol Metabolic Process, Glycosaminoglycan Metabolic Process, Protein targeting to Nucleus, S100 Proteine
-