PLXDC1 Antikörper (N-Term)
-
- Target Alle PLXDC1 Antikörper anzeigen
- PLXDC1 (Plexin Domain Containing 1 (PLXDC1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PLXDC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PLXDC1 antibody was raised against the N terminal of PLXDC1
- Aufreinigung
- Affinity purified
- Immunogen
- PLXDC1 antibody was raised using the N terminal of PLXDC1 corresponding to a region with amino acids MDTLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQVKIHT
- Top Product
- Discover our top product PLXDC1 Primärantikörper
-
anti-Plexin Domain Containing 1 (PLXDC1) (AA 313-421) antibody
PLXDC1 Reaktivität: Human WB, ELISA, RNAi Wirt: Maus Monoclonal 4B10 unconjugated
anti-Plexin Domain Containing 1 (PLXDC1) (AA 1-500) antibodyPLXDC1 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Plexin Domain Containing 1 (PLXDC1) (AA 74-123) antibodyPLXDC1 Reaktivität: Human, Maus, Ratte, Hund, Pferd, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Plexin Domain Containing 1 (PLXDC1) (AA 466-494), (C-Term) antibodyPLXDC1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB30617 unconjugated
anti-Plexin Domain Containing 1 (PLXDC1) (AA 1-500) antibodyPLXDC1 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Plexin Domain Containing 1 (PLXDC1) (N-Term) antibodyPLXDC1 Reaktivität: Human, Maus, Ratte, Hund, Pferd, Rind (Kuh), Meerschweinchen, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-Plexin Domain Containing 1 (PLXDC1) (C-Term) antibodyPLXDC1 Reaktivität: Human, Maus, Ratte WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PLXDC1 Blocking Peptide, catalog no. 33R-5878, is also available for use as a blocking control in assays to test for specificity of this PLXDC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLXDC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLXDC1 (Plexin Domain Containing 1 (PLXDC1))
- Andere Bezeichnung
- PLXDC1 (PLXDC1 Produkte)
- Synonyme
- PLXDC1 antikoerper, TEM3 antikoerper, TEM7 antikoerper, 2410003I07Rik antikoerper, AI848450 antikoerper, Tem7 antikoerper, Arl12 antikoerper, plexin domain containing 1 antikoerper, PLXDC1 antikoerper, Plxdc1 antikoerper
- Hintergrund
- PLXDC1 (TEM7) may play significant role in proliferation and maintenance of neovascular endothelial cells in fibrovascular membranes. TEM7 may be molecular target for new diagnostic and therapeutic strategies for proliferative diabetic retinopathy. The expression level of TEM7 closely parallels histology-based prognostication of osteogenic sarcoma metastasis and, therefore, it is a therapeutic target.
- Molekulargewicht
- 54 kDa (MW of target protein)
-
