PURB Antikörper (N-Term)

Produktnummer ABIN633184

Produktdetails anti-PURB Antikörper

Target: PURB (Purine-Rich Element Binding Protein B (PURB))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PURB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PURB antibody was raised against the N terminal of PURB

Aufreinigung: Affinity purified

Immunogen: PURB antibody was raised using the N terminal of PURB corresponding to a region with amino acids MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PURB Blocking Peptide, catalog no. 33R-5621, is also available for use as a blocking control in assays to test for specificity of this PURB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PURB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PURB

Target: PURB (Purine-Rich Element Binding Protein B (PURB))

Andere Bezeichnung: PURB (PURB Produkte)

Synonyme: 2310015K15Rik antikoerper, AA114818 antikoerper, Cager-2 antikoerper, D11Bwg0414e antikoerper, pur-beta antikoerper, purb antikoerper, zgc:65916 antikoerper, purb-b antikoerper, purbeta antikoerper, PURBETA antikoerper, si:dkey-202n14.1 antikoerper, purine rich element binding protein B antikoerper, purine-rich element binding protein Bb antikoerper, purine-rich element binding protein B L homeolog antikoerper, purine-rich element binding protein Ba antikoerper, Purb antikoerper, purbb antikoerper, purb.L antikoerper, PURB antikoerper, purba antikoerper

Hintergrund: This gene product is a sequence-specific, single-stranded DNA-binding protein.

Molekulargewicht: 33 kDa (MW of target protein)