PURB Antikörper (N-Term)
-
- Target Alle PURB Antikörper anzeigen
- PURB (Purine-Rich Element Binding Protein B (PURB))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PURB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PURB antibody was raised against the N terminal of PURB
- Aufreinigung
- Affinity purified
- Immunogen
- PURB antibody was raised using the N terminal of PURB corresponding to a region with amino acids MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDV
- Top Product
- Discover our top product PURB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PURB Blocking Peptide, catalog no. 33R-5621, is also available for use as a blocking control in assays to test for specificity of this PURB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PURB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PURB (Purine-Rich Element Binding Protein B (PURB))
- Andere Bezeichnung
- PURB (PURB Produkte)
- Synonyme
- 2310015K15Rik antikoerper, AA114818 antikoerper, Cager-2 antikoerper, D11Bwg0414e antikoerper, pur-beta antikoerper, purb antikoerper, zgc:65916 antikoerper, purb-b antikoerper, purbeta antikoerper, PURBETA antikoerper, si:dkey-202n14.1 antikoerper, purine rich element binding protein B antikoerper, purine-rich element binding protein Bb antikoerper, purine-rich element binding protein B L homeolog antikoerper, purine-rich element binding protein Ba antikoerper, Purb antikoerper, purbb antikoerper, purb.L antikoerper, PURB antikoerper, purba antikoerper
- Hintergrund
- This gene product is a sequence-specific, single-stranded DNA-binding protein.
- Molekulargewicht
- 33 kDa (MW of target protein)
-