TDRD9 Antikörper (Middle Region)

Produktnummer ABIN633194

Produktdetails anti-TDRD9 Antikörper

Target: TDRD9 (Tudor Domain Containing 9 (TDRD9))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TDRD9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TDRD9 antibody was raised against the middle region of TDRD9

Aufreinigung: Affinity purified

Immunogen: TDRD9 antibody was raised using the middle region of TDRD9 corresponding to a region with amino acids AINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENMTDGSVPFPM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TDRD9 Blocking Peptide, catalog no. 33R-1276, is also available for use as a blocking control in assays to test for specificity of this TDRD9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TDRD9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TDRD9

Target: TDRD9 (Tudor Domain Containing 9 (TDRD9))

Andere Bezeichnung: TDRD9 (TDRD9 Produkte)

Synonyme: MGC146806 antikoerper, C14orf75 antikoerper, HIG-1 antikoerper, NET54 antikoerper, 4930441E05Rik antikoerper, si:dkey-15f17.9 antikoerper, tdrd9l antikoerper, tudor domain containing 9 antikoerper, TDRD9 antikoerper, tdrd9 antikoerper, Tdrd9 antikoerper

Hintergrund: TDRD9 contains 1 helicase ATP-binding domain and 1 helicase C-terminal domain. The exact function of TDRD9 is not known.

Molekulargewicht: 103 kDa (MW of target protein)