DDX52 Antikörper
-
- Target Alle DDX52 Antikörper anzeigen
- DDX52 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 52 (DDX52))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DDX52 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DDX52 antibody was raised using a synthetic peptide corresponding to a region with amino acids YDFDSSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKRE
- Top Product
- Discover our top product DDX52 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DDX52 Blocking Peptide, catalog no. 33R-10066, is also available for use as a blocking control in assays to test for specificity of this DDX52 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX52 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX52 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 52 (DDX52))
- Andere Bezeichnung
- DDX52 (DDX52 Produkte)
- Synonyme
- HUSSY19 antikoerper, ROK1 antikoerper, 2700029C06Rik antikoerper, Rok1 antikoerper, DExD-box helicase 52 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 52 antikoerper, DEAD-box helicase 52 S homeolog antikoerper, DEAD-box helicase 52 antikoerper, DDX52 antikoerper, ddx52 antikoerper, ddx52.S antikoerper, Ddx52 antikoerper
- Hintergrund
- The function of DDX52 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 67 kDa (MW of target protein)
-