RDBP Antikörper (N-Term)

Produktnummer ABIN633203

Produktdetails anti-RDBP Antikörper

Target: RDBP (RD RNA Binding Protein (RDBP))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RDBP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RDBP antibody was raised against the N terminal of RDBP

Aufreinigung: Affinity purified

Immunogen: RDBP antibody was raised using the N terminal of RDBP corresponding to a region with amino acids QSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVKSGAISAIKAETKNS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RDBP Blocking Peptide, catalog no. 33R-7738, is also available for use as a blocking control in assays to test for specificity of this RDBP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDBP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RDBP

Target: RDBP (RD RNA Binding Protein (RDBP))

Andere Bezeichnung: RDBP (RDBP Produkte)

Synonyme: CG5994 antikoerper, Dmel\\CG5994 antikoerper, NELF antikoerper, NELF-E antikoerper, Nelf-e antikoerper, anon-66Da antikoerper, cg5994 antikoerper, dNelf-E antikoerper, D6S45 antikoerper, RD antikoerper, RDBP antikoerper, RDP antikoerper, Rd antikoerper, Rdbp antikoerper, D17H6S45 antikoerper, Negative elongation factor E antikoerper, negative elongation factor complex member E antikoerper, negative elongation factor complex member E, Rdbp antikoerper, Nelf-E antikoerper, NELFE antikoerper, Nelfe antikoerper

Hintergrund: RDBP is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins, however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D). The protein encoded by this gene is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation.

Molekulargewicht: 43 kDa (MW of target protein)