DAZ1 Antikörper (N-Term)
-
- Target Alle DAZ1 Antikörper anzeigen
- DAZ1 (Deleted in Azoospermia 1 (DAZ1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DAZ1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DAZ1 antibody was raised against the N terminal of DAZ1
- Aufreinigung
- Affinity purified
- Immunogen
- DAZ1 antibody was raised using the N terminal of DAZ1 corresponding to a region with amino acids MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR
- Top Product
- Discover our top product DAZ1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DAZ1 Blocking Peptide, catalog no. 33R-6391, is also available for use as a blocking control in assays to test for specificity of this DAZ1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DAZ1 (Deleted in Azoospermia 1 (DAZ1))
- Andere Bezeichnung
- DAZ1 (DAZ1 Produkte)
- Hintergrund
- DAZ1 is a RNA-binding protein that plays an essential role in spermatogenesis. DAZ1 may act by binding to the 3'-UTR of mRNAs and regulating their translation.
- Molekulargewicht
- 64 kDa (MW of target protein)
-