DAZ1 Antikörper (N-Term)

Produktnummer ABIN633207

Produktdetails anti-DAZ1 Antikörper

Target: DAZ1 (Deleted in Azoospermia 1 (DAZ1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DAZ1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DAZ1 antibody was raised against the N terminal of DAZ1

Aufreinigung: Affinity purified

Immunogen: DAZ1 antibody was raised using the N terminal of DAZ1 corresponding to a region with amino acids MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DAZ1 Blocking Peptide, catalog no. 33R-6391, is also available for use as a blocking control in assays to test for specificity of this DAZ1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DAZ1

Target: DAZ1 (Deleted in Azoospermia 1 (DAZ1))

Andere Bezeichnung: DAZ1 (DAZ1 Produkte)

Synonyme: DAZ1 antikoerper, DAZ4 antikoerper, DAZ antikoerper, SPGY antikoerper, deleted in azoospermia protein 1 antikoerper, deleted in azoospermia 1 antikoerper, LOC749905 antikoerper, DAZ1 antikoerper

Hintergrund: DAZ1 is a RNA-binding protein that plays an essential role in spermatogenesis. DAZ1 may act by binding to the 3'-UTR of mRNAs and regulating their translation.

Molekulargewicht: 64 kDa (MW of target protein)