SLBP Antikörper

Produktnummer ABIN633212

Produktdetails anti-SLBP Antikörper

Target: SLBP (Stem-Loop Binding Protein (SLBP))

Reaktivität: Human, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLBP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids INYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWK

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLBP Blocking Peptide, catalog no. 33R-4084, is also available for use as a blocking control in assays to test for specificity of this SLBP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLBP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLBP

Target: SLBP (Stem-Loop Binding Protein (SLBP))

Andere Bezeichnung: SLBP (SLBP Produkte)

Synonyme: CG11886 antikoerper, Dmel\\CG11886 antikoerper, SLBP antikoerper, dSLBP antikoerper, dSLPB antikoerper, slbp antikoerper, cb157 antikoerper, sb:cb157 antikoerper, si:dkey-102m7.2 antikoerper, GB13630 antikoerper, HBP antikoerper, slbp1 antikoerper, xslbp antikoerper, stem-loop binding protein antikoerper, Stem-loop binding protein antikoerper, histone RNA hairpin-binding protein antikoerper, stem-loop binding protein L homeolog antikoerper, Slbp antikoerper, slbp antikoerper, SLBP antikoerper, LOC726745 antikoerper, EHI_178590 antikoerper, CpipJ_CPIJ008644 antikoerper, slbp.L antikoerper

Hintergrund: SLBP binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1.

Molekulargewicht: 30 kDa (MW of target protein)