HNRNPK Antikörper (N-Term)

Produktnummer ABIN633224

Produktdetails anti-HNRNPK Antikörper

Target: HNRNPK (Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRNPK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: HNRPK antibody was raised against the N terminal of HNRPK

Aufreinigung: Affinity purified

Immunogen: HNRPK antibody was raised using the N terminal of HNRPK corresponding to a region with amino acids NTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKG

Anwendungsinformationen

Applikationshinweise: WB: 0.2-1 µg/mL, IHC: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HNRPK Blocking Peptide, catalog no. 33R-6896, is also available for use as a blocking control in assays to test for specificity of this HNRPK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNRNPK

Target: HNRNPK (Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK))

Andere Bezeichnung: HNRPK (HNRNPK Produkte)

Synonyme: CSBP antikoerper, HNRPK antikoerper, TUNP antikoerper, Csbp antikoerper, Hnrpk antikoerper, hnrpk antikoerper, MGC75642 antikoerper, wu:fb37h02 antikoerper, wu:fi34c04 antikoerper, zgc:66162 antikoerper, KBBP antikoerper, NOVA antikoerper, heterogeneous nuclear ribonucleoprotein K antikoerper, heterogeneous nuclear ribonucleoprotein K S homeolog antikoerper, heterogeneous nuclear ribonucleoprotein k antikoerper, HNRNPK antikoerper, Hnrnpk antikoerper, hnrnpk.S antikoerper, hnrnpk antikoerper, LOC5565718 antikoerper, CpipJ_CPIJ000130 antikoerper, NGK_p0004 antikoerper

Hintergrund: HNRPK belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). The hnRNP proteins have distinct nucleic acid binding properties. HNRPK is located in the nucleoplasm and has three repeats of KH domains that binds to RNAs. It is distinct among other hnRNP proteins in its binding preference, it binds tenaciously to poly(C). This protein is also thought to have a role during cell cycle progession. Multiple alternatively spliced transcript variants have been described for this gene but only three variants have been fully described.

Molekulargewicht: 51 kDa (MW of target protein)