NXF1 Antikörper (N-Term)

Produktnummer ABIN633230

Produktdetails anti-NXF1 Antikörper

Target: NXF1 (Nuclear RNA Export Factor 1 (NXF1))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NXF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NXF1 antibody was raised against the N terminal of NXF1

Aufreinigung: Affinity purified

Immunogen: NXF1 antibody was raised using the N terminal of NXF1 corresponding to a region with amino acids RPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYG

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NXF1 Blocking Peptide, catalog no. 33R-8098, is also available for use as a blocking control in assays to test for specificity of this NXF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NXF1

Target: NXF1 (Nuclear RNA Export Factor 1 (NXF1))

Andere Bezeichnung: NXF1 (NXF1 Produkte)

Synonyme: im:7156527 antikoerper, wu:fc12d06 antikoerper, MGC82224 antikoerper, NXF1 antikoerper, tap antikoerper, mex67 antikoerper, MEX67 antikoerper, TAP antikoerper, Mex67 antikoerper, Mvb1 antikoerper, Tap antikoerper, Mex67h antikoerper, nuclear RNA export factor 1 antikoerper, nuclear RNA export factor 1 S homeolog antikoerper, Nuclear RNA export factor 1 antikoerper, nxf1 antikoerper, nxf1.S antikoerper, NXF1 antikoerper, LOC100113601 antikoerper, Tsp_03999 antikoerper, Nxf1 antikoerper, nxf-1 antikoerper

Hintergrund: NXF1 is one member of a family of nuclear RNA export factor. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF1 shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ RNA. NXF1 overcomes the mRNA export block caused by the presence of saturating amounts of CTE (constitutive transport element) RNA of type D retroviruses.

Molekulargewicht: 68 kDa (MW of target protein)