NXF3 Antikörper (N-Term)
-
- Target Alle NXF3 Antikörper anzeigen
- NXF3 (Nuclear RNA Export Factor 3 (NXF3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NXF3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NXF3 antibody was raised against the N terminal of NXF3
- Aufreinigung
- Affinity purified
- Immunogen
- NXF3 antibody was raised using the N terminal of NXF3 corresponding to a region with amino acids SLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSEPVNPGMHSSSHQQQDG
- Top Product
- Discover our top product NXF3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NXF3 Blocking Peptide, catalog no. 33R-8615, is also available for use as a blocking control in assays to test for specificity of this NXF3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXF3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NXF3 (Nuclear RNA Export Factor 3 (NXF3))
- Andere Bezeichnung
- NXF3 (NXF3 Produkte)
- Synonyme
- NXF3 antikoerper, Gm384 antikoerper, RGD1564923 antikoerper, nuclear RNA export factor 3 antikoerper, NXF3 antikoerper, LOC523530 antikoerper, LOC100060140 antikoerper, LOC100060240 antikoerper, LOC785244 antikoerper, Nxf3 antikoerper
- Hintergrund
- NXF3 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF3 has shortened LRR and ubiquitin-associated domains and its RDB is unable to bind RNA. It is located in the nucleoplasm but is not associated with either the nuclear envelope or the nucleolus.
- Molekulargewicht
- 60 kDa (MW of target protein)
-