SNRPD2 Antikörper (Middle Region)
-
- Target Alle SNRPD2 Antikörper anzeigen
- SNRPD2 (Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SNRPD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SNRPD2 antibody was raised against the middle region of SNRPD2
- Aufreinigung
- Affinity purified
- Immunogen
- SNRPD2 antibody was raised using the middle region of SNRPD2 corresponding to a region with amino acids ENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAG
- Top Product
- Discover our top product SNRPD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SNRPD2 Blocking Peptide, catalog no. 33R-2619, is also available for use as a blocking control in assays to test for specificity of this SNRPD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SNRPD2 (Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2))
- Andere Bezeichnung
- SNRPD2 (SNRPD2 Produkte)
- Synonyme
- SMD2 antikoerper, SNRPD1 antikoerper, Sm-D2 antikoerper, sm-d2 antikoerper, smd2 antikoerper, snrpd1 antikoerper, 170.t00019 antikoerper, NCU03778.1 antikoerper, 1810009A06Rik antikoerper, im:6908977 antikoerper, si:dkey-113g17.2 antikoerper, zgc:110732 antikoerper, small nuclear ribonucleoprotein D2 polypeptide antikoerper, small nuclear ribonucleoprotein D2 polypeptide L homeolog antikoerper, small nuclear ribonucleoprotein Sm D2 antikoerper, small nuclear ribonucleoprotein sm D2 antikoerper, small nuclear ribonucleoprotein sm d2 antikoerper, small nuclear ribonucleoprotein D2 antikoerper, SNRPD2 antikoerper, snrpd2 antikoerper, snrpd2.L antikoerper, EHI_108640 antikoerper, NCU03778 antikoerper, PVX_002615 antikoerper, SMP4 antikoerper, EDI_187160 antikoerper, LOC100036587 antikoerper, Snrpd2 antikoerper
- Hintergrund
- SNRPD2 belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene.
- Molekulargewicht
- 13 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-